DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstT1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:212 Identity:54/212 - (25%)
Similarity:99/212 - (46%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRA 68
            ||...|.|.|: |..|..||....:...:..|.:||.|.||..||....:|.:.|..|.|.||.:
  Fly     8 YYDFLSQPSRA-LWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVS 71

  Fly    69 IMVYLVEKYGKDDKLFPKDVQKQALINQRL---YFDMGTLYKSFSEYYYPQIFL---------KK 121
            |:.||.:|....::|:||.::::|.:::.|   :|::    :.....::.|::|         .|
  Fly    72 IVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNV----RLVCSLFFRQVWLLPAKGLAPAPK 132

  Fly   122 PANEENYKK----IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDF--KRYANV 180
            |   |:.||    :|.....|......:.:..|...::|||...:.::...:..::.  |::..|
  Fly   133 P---ESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKV 194

  Fly   181 ARWYENAKKLT-PGWEE 196
            |:|.|..:..| |.::|
  Fly   195 AKWMERVRDATNPYYDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 26/70 (37%)
PLN02473 3..196 CDD:166114 53/210 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/127 (19%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 51/203 (25%)
GST_N_Theta 5..80 CDD:239348 26/72 (36%)
GST_C_Theta 93..218 CDD:198292 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.