DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE13

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:199 Identity:59/199 - (29%)
Similarity:110/199 - (55%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHD-HGFALWES 66
            |||...|.|.|:.::.||.:|::.:.|. ::...:|..:.|::|:||||.||...| .|....:|
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKP-VDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDS 69

  Fly    67 RAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKI 131
            .||:.:||.||..:|:|:|:|::::|.|:.|::::.|.|::...:.....|:  ....|.|.:.:
  Fly    70 HAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY--GGEGEYNPRSL 132

  Fly   132 EV---AFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFD-VAGFDFKRYANVARWYENAKKLTP 192
            .:   |:..|..||:..::..|.:.|:||::...|:.|.| :...:.::|....:|.|...||.|
  Fly   133 TLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLP 197

  Fly   193 GWEE 196
            ..||
  Fly   198 DNEE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/72 (35%)
PLN02473 3..196 CDD:166114 57/197 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/112 (24%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460281
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.