DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and clic1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:244 Identity:49/244 - (20%)
Similarity:79/244 - (32%) Gaps:71/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGS-----APC---RSVLMTAKALGVEFDKKTIINTRAREQFTPEYLK-INPQHTIPTL 56
            ::|:.:.||     ..|   :.:.|.....||.|:..|:...|     .||.|| :.|....|  
Zfish     8 VELFVKAGSDGQSIGNCPFSQRLFMVLWLKGVTFNVTTVDMKR-----KPEILKDLAPGAQPP-- 65

  Fly    57 HDHGFALW------ESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYY-- 113
                |.|:      ::..|..:|      ::.|.|....:.|..|.........::..||.|.  
Zfish    66 ----FLLYGTEVKTDTNKIEEFL------EETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKN 120

  Fly   114 -YPQI-----------------FLKKPANEE-NYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIA 159
             .||:                 :|..|..:| :....:.......:||:||      :.:|||..
Zfish   121 SNPQMNDNLEKGLLKALKKLDDYLSSPLPDEIDENSADDVISSTRSFLDGQ------ELTLADCN 179

  Fly   160 FLATVSTFDVAGFDFK------------RYANVARWYENAKKLTPGWEE 196
            .|..:....|....|:            ||.:.|...|......|..||
Zfish   180 LLPKLHIVKVVCLKFRGFSIPRSLTSLWRYLDAAYAREEFSSTCPSDEE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/88 (23%)
PLN02473 3..196 CDD:166114 47/240 (20%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/141 (19%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 22/101 (22%)
O-ClC 6..241 CDD:129941 49/244 (20%)
GST_C_CLIC1 100..238 CDD:198333 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.