DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Clic

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:147 Identity:33/147 - (22%)
Similarity:54/147 - (36%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            ||||            :.|:...:.....|:...:....|...:...:|    |.|.|:|.|:.|
  Fly    48 MDLY------------LLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILE 96

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKK 130
            :..|..::::.......||.:|.:...|| :.||..:..:.....|       .|..|...:.:|
  Fly    97 NEKIERHIMKNIPGGYNLFVQDKEVATLI-ENLYVKLKLMLVKKDE-------AKNNALLSHLRK 153

  Fly   131 IEVAFEFLNT-FLEGQT 146
            |.......|| ||.|.|
  Fly   154 INDHLSARNTRFLTGDT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 15/73 (21%)
PLN02473 3..196 CDD:166114 31/145 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 15/59 (25%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 15/79 (19%)
O-ClC 21..231 CDD:129941 33/147 (22%)
GST_C_CLIC 118..232 CDD:198307 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.