DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Clic4

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:178 Identity:37/178 - (20%)
Similarity:66/178 - (37%) Gaps:44/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEFDKKTIINTRAREQF------TPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDK 82
            :.|:.:...:....|:|      .|:|||::|:|  |..:..|..::..       ...|.|:.:
Mouse    78 ITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAK-------FSAYIKNSR 133

  Fly    83 LFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEF-LNTFLEGQT 146
            ....:..::.|:.        ||.| ..||      |..|..:|..:......:| ...||:|. 
Mouse   134 PEANEALERGLLK--------TLQK-LDEY------LNSPLPDEIDENSMEDIKFSTRRFLDGD- 182

  Fly   147 YSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGW 194
                 :.:|||...|..:....|..   |:|.|    ::..|.:|..|
Mouse   183 -----EMTLADCNLLPKLHIVKVVA---KKYRN----FDIPKGMTGIW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 11/56 (20%)
PLN02473 3..196 CDD:166114 37/178 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/107 (22%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 3/22 (14%)
O-ClC 17..252 CDD:129941 37/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.