DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Clic3

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:211 Identity:44/211 - (20%)
Similarity:75/211 - (35%) Gaps:52/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSAP-CRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLK-INPQHTIPTLHDHGFALWESRAIM 70
            |..| |:.:.|.....||.|...|:...||.     :.|| ..|...:|.|...|....::..|.
  Rat    21 GHCPSCQRLFMVLLLKGVPFTLTTVDTRRAL-----DVLKDFAPGSQLPILLYDGDVKTDTLQIE 80

  Fly    71 VYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGT----LYKSFSEYYYPQIFLKKPANEEN---Y 128
            .:|.|..|..|  ||....:        |.:..|    ::..||      .|:|.|...::   |
  Rat    81 EFLEETLGPPD--FPGLAPR--------YRESNTAGNDIFHKFS------AFIKNPVPTQDDALY 129

  Fly   129 KKIEVAFEFLNTFL----------------EGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKR- 176
            :::..|...|:.:|                ..:.:..|...:|||.:.|..:...|.....|:: 
  Rat   130 QQLLRALTRLDRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQR 194

  Fly   177 -----YANVARWYENA 187
                 .:.|.|:.::|
  Rat   195 PIPAELSCVRRYLDSA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 18/68 (26%)
PLN02473 3..196 CDD:166114 44/211 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/128 (16%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.