DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Gstt2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus


Alignment Length:220 Identity:60/220 - (27%)
Similarity:100/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAR---EQFTPEYLKINPQHTIPTLHDHGFA 62
            ::||....|.|.|:|.:.||..|:.|..:|:...:.:   |||:    ::|....:|.|.|..|.
  Rat     3 LELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFS----QVNCLKKVPVLKDGSFV 63

  Fly    63 LWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYY-----PQIFLKKP 122
            |.||.||::||..||...|..:|.|:|.:|.:::.|.:....:..:|....:     |.|.::.|
  Rat    64 LTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVP 128

  Fly   123 AN--EENYKKIEVAFEFL-NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWY 184
            ..  |.|...:.:|.:.| :.||..:.:.||...:|||:..|..:         .:..|.....:
  Rat   129 EEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSLEEL---------IQPVALGCNLF 184

  Fly   185 ENAKKLTPGWEEN---WAG---CQE 203
            |...:|| .|.|.   :.|   |||
  Rat   185 EGRPQLT-AWRERVEAFLGAELCQE 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 26/76 (34%)
PLN02473 3..196 CDD:166114 55/203 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/129 (22%)
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 26/78 (33%)