DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Eef1e1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001099576.1 Gene:Eef1e1 / 291057 RGDID:1311056 Length:174 Species:Rattus norvegicus


Alignment Length:138 Identity:37/138 - (26%)
Similarity:63/138 - (45%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QHTIPTLH-DHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYY 113
            :..:|.|. ::|.:|.....|..:||::..| :.|.....:::||:.|.|.|.: |.....|...
  Rat    27 ERQVPVLQTNNGPSLMGLSTIATHLVKEANK-EHLLGSTAEEKALVQQWLEFRI-TRVDGHSSKE 89

  Fly   114 YPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTF--DVAGFDFKR 176
            ..|..||.                ||::||.:.|.||.:.:||||.....:..|  |:...:.::
  Rat    90 DTQTLLKD----------------LNSYLEDKVYLAGHNTTLADILLYYGLHRFIVDLTVQEKEK 138

  Fly   177 YANVARWY 184
            |.||:||:
  Rat   139 YLNVSRWF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 6/25 (24%)
PLN02473 3..196 CDD:166114 37/138 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/98 (29%)
Eef1e1NP_001099576.1 GST_C_AIMP3 65..165 CDD:198338 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.