DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and AIMP3

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:69 Identity:16/69 - (23%)
Similarity:36/69 - (52%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFD----VAGFDFKRYANVAR 182
            |.:::.|...::..:| |.....::|..|...:|||:|....:  :|    ::..|.:.|.|::|
  Fly    84 PGSKDKYVSKQLLADF-NKLFASKSYLVGHFITLADLAVYYAI--YDLVKSLSPVDKEVYLNLSR 145

  Fly   183 WYEN 186
            |:::
  Fly   146 WFDH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343
PLN02473 3..196 CDD:166114 16/69 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 16/69 (23%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.