DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Clic5

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:198 Identity:40/198 - (20%)
Similarity:66/198 - (33%) Gaps:60/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAPCRSVLMTAKALGVEFDKKTIIN---TRAREQFTPE-YLKINPQHTIPTLHDHGFALWESR 67
            ||:.|        ..|....|.||.:|   ....|..||| |.|:..:|.            ||.
Mouse   302 PGTHP--------PFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHR------------ESN 346

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIE 132
            ...:.:..|:    ..:.|:.::|.  |..|...:....:...:|      |..|..||      
Mouse   347 TAGIDIFSKF----SAYIKNTKQQN--NAALERGLTKALRKLDDY------LNSPLPEE------ 393

  Fly   133 VAFEFLNTFLEG------QTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLT 191
                 ::|...|      :.:..|.:.:|||...|..:....:..   |:|.|    |:...::|
Mouse   394 -----IDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVA---KKYRN----YDIPAEMT 446

  Fly   192 PGW 194
            ..|
Mouse   447 GLW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 17/71 (24%)
PLN02473 3..196 CDD:166114 40/198 (20%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/112 (19%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.