Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 40/198 - (20%) |
---|---|---|---|
Similarity: | 66/198 - (33%) | Gaps: | 60/198 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PGSAPCRSVLMTAKALGVEFDKKTIIN---TRAREQFTPE-YLKINPQHTIPTLHDHGFALWESR 67
Fly 68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIE 132
Fly 133 VAFEFLNTFLEG------QTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLT 191
Fly 192 PGW 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 17/71 (24%) |
PLN02473 | 3..196 | CDD:166114 | 40/198 (20%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 21/112 (19%) | ||
Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 40/198 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844773 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |