DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gst-43

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:190 Identity:47/190 - (24%)
Similarity:76/190 - (40%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRA 68
            |:|...|....:.:..|.:..|:....:.:..::.  ..|::|.||...:|||..:|.:|.||.|
 Worm     9 YWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKN--NAEFVKHNPAKKVPTLVINGLSLTESLA 71

  Fly    69 IMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEEN------ 127
            |:.||.|.| .|....||::.|      |.|.....|:...|......|.:.|..||:.      
 Worm    72 IIEYLDEAY-PDPPFLPKELDK------RSYSRAIALHIVASIQPLQAINIHKMLNEKEPGYGDF 129

  Fly   128 -----YKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVAR 182
                 ..|..:|.|.|.....|: |..|...::|||...:.:....:...|..:|..:.|
 Worm   130 WCNHFVNKGFLALEELLKKHSGK-YCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/70 (29%)
PLN02473 3..196 CDD:166114 47/190 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/105 (21%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 19/69 (28%)
maiA 5..211 CDD:273527 47/190 (25%)
GST_C_Zeta 90..207 CDD:198300 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163425
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.