Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497118.1 | Gene: | gst-29 / 190225 | WormBaseID: | WBGene00001777 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 77/199 - (38%) | Gaps: | 48/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 RPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQF-----TPEYLK-INPQHTIPTLHDHGFALW 64
Fly 65 ESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYK 129
Fly 130 KIEVA--------------FEFLNTFLEGQT--YSAGGDYSLADIAFLATVSTFD-VAGFDFKRY 177
Fly 178 ANVA 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 23/74 (31%) |
PLN02473 | 3..196 | CDD:166114 | 47/199 (24%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 21/110 (19%) | ||
gst-29 | NP_497118.1 | GST_N_Sigma_like | 4..74 | CDD:239337 | 22/73 (30%) |
PTZ00057 | 6..209 | CDD:173353 | 47/199 (24%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 21/114 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |