DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gst-29

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:199 Identity:47/199 - (23%)
Similarity:77/199 - (38%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQF-----TPEYLK-INPQHTIPTLHDHGFALW 64
            |..:.|.|.:...|   ||.||.         .:|     |.|.|| ..|...:|.|:..||.:.
 Worm    12 RAYAEPARILFHLA---GVPFDD---------HRFPHGDGTWEKLKDKTPFGQVPVLYVDGFEIP 64

  Fly    65 ESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYK 129
            :|.||:.||..|:|...|...:.....|:::|  :.|..:|::.|           |.|.:....
 Worm    65 QSAAIIRYLANKFGYAGKTPEEQAWADAIVDQ--FKDFMSLFREF-----------KLAQKAGKS 116

  Fly   130 KIEVA--------------FEFLNTFLEGQT--YSAGGDYSLADIAFLATVSTFD-VAGFDFKRY 177
            .:|:|              ||.:...||...  :..|...:.|||..:.:::..: |..||...:
 Worm   117 DVEIAKVASEVAIPARDSYFEIITNLLEKSKSGFLVGDGLTFADIVVVESLTNLEKVHFFDASEH 181

  Fly   178 ANVA 181
            ..:|
 Worm   182 PKLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 23/74 (31%)
PLN02473 3..196 CDD:166114 47/199 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/110 (19%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 22/73 (30%)
PTZ00057 6..209 CDD:173353 47/199 (24%)
GST_C_Sigma_like 85..191 CDD:198301 21/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.