| Sequence 1: | NP_652713.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001022266.1 | Gene: | gst-9 / 187615 | WormBaseID: | WBGene00001757 | Length: | 206 | Species: | Caenorhabditis elegans |
| Alignment Length: | 162 | Identity: | 39/162 - (24%) |
|---|---|---|---|
| Similarity: | 64/162 - (39%) | Gaps: | 48/162 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 GVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKD 87
Fly 88 VQKQAL--------INQRLYF---------DMGTLYK-----SFSEYYYPQIF---LKKPAN--- 124
Fly 125 -------------EENYKKIEVAFEFLNTFLE 143 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD10 | NP_652713.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 16/51 (31%) |
| GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 21/96 (22%) | ||
| gst-9 | NP_001022266.1 | GST_N_Sigma_like | 4..73 | CDD:239337 | 16/51 (31%) |
| PTZ00057 | 6..201 | CDD:173353 | 39/162 (24%) |