DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gst-14

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:208 Identity:47/208 - (22%)
Similarity:81/208 - (38%) Gaps:42/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YRPGSAPCRSVLMTAKAL----GVEFDKKTIINTRAREQF---TPEYLK-INPQHTIPTLHDHGF 61
            |:....|.|.:..:|:.|    ||.|:.:       |..|   |.|.:| ..|...:|.|....|
 Worm     4 YKLSYFPVRGLAESARLLFHLAGVPFEDE-------RVNFLDDTWEKMKGKTPMGQLPVLTVDDF 61

  Fly    62 ALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPA-NE 125
            .:.:|.||..||..|:|...|...::....|:::|         :|.|...:...:..|:.. :.
 Worm    62 EIPQSAAINRYLARKFGFAGKTPEEEAWVDAVVDQ---------FKDFFAEFRKLVIAKRVGKSA 117

  Fly   126 ENYKKI---------EVAFEFLNTFLEGQT--YSAGGDYSLADIAFLATVST------FDVAGFD 173
            |..:|:         :|.|:.||..||...  |..|...:.||:.....:.|      .:.:|..
 Worm   118 EELEKLTAEVIKPAMDVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQ 182

  Fly   174 FKRYANVARWYEN 186
            .|..|::.:.|.:
 Worm   183 PKLAAHLEKVYSH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 22/77 (29%)
PLN02473 3..196 CDD:166114 47/208 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/116 (19%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 22/77 (29%)
PTZ00057 6..205 CDD:173353 46/206 (22%)
GST_C_Sigma_like 85..192 CDD:198301 21/115 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.