DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gst-24

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:189 Identity:48/189 - (25%)
Similarity:79/189 - (41%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYY---RPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQ---HTIPTLHDHGF 61
            |||   |..:.|.|.:.   |...|||:...|      |..|||:..:.|:   ..:|.|...||
 Worm     6 LYYFNLRGWAEPARQLF---KLAHVEFEDVRI------ENGTPEWGALKPKTPFGQLPFLSVDGF 61

  Fly    62 ALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEE 126
            .:.:|.||:.||.:|:|...|...::....|:::|         :|.|.......|..::..|.|
 Worm    62 EIPQSAAILRYLAKKFGYAGKTSEEEAWVDAIVDQ---------FKDFVTPLRQLIMAQRSGNAE 117

  Fly   127 NYKKI---------EVAFEFLNTFLEGQT--YSAGGDYSLADIAFLATVSTFDVAG-FD 173
            ..::|         :..|:.||..||...  :..|...:.||:.....::|.::.| ||
 Worm   118 EIERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGVFD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/77 (32%)
PLN02473 3..196 CDD:166114 48/189 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 20/97 (21%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 25/77 (32%)
PTZ00057 6..208 CDD:173353 48/189 (25%)
GST_C_Sigma_like 85..191 CDD:198301 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.