DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gst-42

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:212 Identity:51/212 - (24%)
Similarity:81/212 - (38%) Gaps:67/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYRPGSAPCRSVLMTAKAL-GVEFDKKTI--INTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            |:|   :.|...:..|.|| .|:::.||:  ::..|:.:..    :|||...:||....|..:.|
 Worm    11 YWR---SSCSWRVRIALALKNVDYEYKTVDLLSEEAKSKLK----EINPAAKVPTFVVDGQVITE 68

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQA---------------LINQRLYFDMGTLYKSFSEYYYP 115
            |.||:.||.|.: .|..|.|||..|:|               |.|.::.                
 Worm    69 SLAIIEYLEETH-PDVPLLPKDPIKRAHARAISLLVASGIQPLHNLKVL---------------- 116

  Fly   116 QIFLKKPANEENYKKIEVAF--EFLNTF-LEGQT------------YSAGGDYSLADIAFLATVS 165
            |:..||          |..|  :|...| :||.|            |:.|.|.::||::....:.
 Worm   117 QLLNKK----------EAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIY 171

  Fly   166 TFDVAGFDFKRYANVAR 182
            :.:....|...|..|.|
 Worm   172 SANRFNLDLSPYPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 22/73 (30%)
PLN02473 3..196 CDD:166114 51/212 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/124 (19%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 21/72 (29%)
maiA 7..211 CDD:273527 51/212 (24%)
GST_C_Zeta 90..207 CDD:198300 23/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.