DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Gstz1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:189 Identity:49/189 - (25%)
Similarity:84/189 - (44%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYRPGSAPCRSVLMTAKAL-GVEFDKKTI-INTRAREQFTPEYLKINPQHTIPTLHDHGFALWES 66
            |:|   :.|...:..|.|| |::::...| :.....:|||.|:..:||...:|.|...|..:.:|
Mouse    11 YFR---SSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQS 72

  Fly    67 RAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYP--QIFLKKPANEEN-- 127
            .|||.|| |:.....:|.|:|.||:|::  |:..|:      .:....|  .:.:.|...:||  
Mouse    73 LAIMEYL-EETRPIPRLLPQDPQKRAIV--RMISDL------IASGIQPLQNLSVLKQVGQENQM 128

  Fly   128 ---YKKIEVAFEFLNTFLEGQT--YSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVA 181
               .|.|...|..|...|:...  |..|.:.|:||:..:..|:..:....|...|..::
Mouse   129 QWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTIS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 23/72 (32%)
PLN02473 3..196 CDD:166114 49/189 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/102 (22%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 23/72 (32%)
maiA 7..211 CDD:273527 49/189 (26%)
Glutathione binding 14..19 1/4 (25%)