DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Gsto1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:171 Identity:47/171 - (27%)
Similarity:73/171 - (42%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAP--------------CRSVLMTAKALGVEFDKKTIINTRAREQFTPE-YLKINPQHTIPTL 56
            ||..|              .:..||..||.|:..:   :||...:.:  || :.:.||...:|.|
Mouse    16 PGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHE---VININLKNK--PEWFFEKNPLGLVPVL 75

  Fly    57 -HDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQI--- 117
             :..|..:.||.....||.|.| .:.||||.|..|:|  .|::     || :|||:  .|.:   
Mouse    76 ENSQGHLVTESVITCEYLDEAY-PEKKLFPDDPYKKA--RQKM-----TL-ESFSK--VPPLIAS 129

  Fly   118 FLK----------KPANEENYKKIEVAFEFLNTFLEGQTYS 148
            |::          :.|.|..:||:|...:...:||.|.:.|
Mouse   130 FVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPS 170

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 21/83 (25%)
PLN02473 3..196 CDD:166114 47/171 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 19/73 (26%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 20/82 (24%)
GstA 26..224 CDD:223698 44/161 (27%)