DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Gdap1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_034397.1 Gene:Gdap1 / 14545 MGIID:1338002 Length:358 Species:Mus musculus


Alignment Length:274 Identity:46/274 - (16%)
Similarity:87/274 - (31%) Gaps:103/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSV--LMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            ||:...|...:.|  ::..|||..|   :..::....|...|.::::|....:|.|......:.|
Mouse    28 LYHWTHSFSSQKVRLVIAEKALKCE---EHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICE 89

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYY----------------- 113
            :..|:.||.:.: .|::            ..||..|.|::|....::|                 
Mouse    90 ATQIIDYLEQTF-LDER------------TPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCI 141

  Fly   114 -YPQIF-----------------------LKKPANE----------------------ENYKKIE 132
             :|::.                       |||.|.|                      :|.|.::
Mouse   142 LHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLK 206

  Fly   133 VAFEFLNTFLE-----------------GQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYA-- 178
            ...:.|...|:                 .|.:..|..::|||::...|:......||..:.:.  
Mouse   207 KILDELEKVLDQVETELQRRNEETPEEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHG 271

  Fly   179 ---NVARWYENAKK 189
               |:..:||...|
Mouse   272 KRPNLETYYERVLK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 17/73 (23%)
PLN02473 3..196 CDD:166114 46/274 (17%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/186 (15%)
Gdap1NP_034397.1 GST_N_GDAP1 26..98 CDD:239350 16/72 (22%)
GST_C_GDAP1 179..289 CDD:198336 16/107 (15%)
Required for mitochondrial localization. /evidence=ECO:0000250 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.