DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and AIMP3

DIOPT Version :10

Sequence 1:NP_652713.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:79 Identity:18/79 - (22%)
Similarity:43/79 - (54%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATV--STFDVAGFDFKR 176
            |..:|: .|:|::.:....:..| ||.:|:.::|......|:||:....|:  :..::...:.:.
Mosquito    78 YAVLFV-APSNKDKHTAKSLLDE-LNFYLQSRSYLVNDTLSVADVVVFHTIHETMANLQPLEKEN 140

  Fly   177 YANVARWYENAKKL 190
            :.||:||:.:.::|
Mosquito   141 FLNVSRWFHHLQQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_652713.1 GST_N_Delta_Epsilon 1..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287 18/79 (23%)
AIMP3XP_061501516.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.