DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and CLIC2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:227 Identity:53/227 - (23%)
Similarity:81/227 - (35%) Gaps:82/227 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSAP-CRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMV 71
            |:.| |:.:.|.....||:|:..|:..||     .||.||.....|.|             ..:|
Human    28 GNCPFCQRLFMILWLKGVKFNVTTVDMTR-----KPEELKDLAPGTNP-------------PFLV 74

  Fly    72 YLVEKYGKDDKLFPKDVQKQALINQRL---------YFDMG-TLYKSFSEYYYPQIFLKKPANEE 126
            |  .|..|.|.:..::..:|.|...|.         .||:| .|:..||.|      :|....|.
Human    75 Y--NKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAY------IKNTQKEA 131

  Fly   127 N----------YKKIEVAFEFLNT--------------------FLEGQTYSAGGDYSLADIAFL 161
            |          :|:::   ::|||                    ||:|.      ..:|||.:.|
Human   132 NKNFEKSLLKEFKRLD---DYLNTPLLDEIDPDSAEEPPVSRRLFLDGD------QLTLADCSLL 187

  Fly   162 ATVSTFDVAG-----FDF-KRYANVARWYENA 187
            ..::...||.     ||. ..::.|.|:..||
Human   188 PKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 18/67 (27%)
PLN02473 3..196 CDD:166114 53/227 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/145 (22%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 23/87 (26%)
N-terminal 1..94 22/85 (26%)
O-ClC 12..245 CDD:129941 53/227 (23%)
Joint loop 95..106 1/10 (10%)
C-terminal 107..247 29/128 (23%)
Foot loop 151..171 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.