Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001280.3 | Gene: | CLIC2 / 1193 | HGNCID: | 2063 | Length: | 247 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 53/227 - (23%) |
---|---|---|---|
Similarity: | 81/227 - (35%) | Gaps: | 82/227 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GSAP-CRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMV 71
Fly 72 YLVEKYGKDDKLFPKDVQKQALINQRL---------YFDMG-TLYKSFSEYYYPQIFLKKPANEE 126
Fly 127 N----------YKKIEVAFEFLNT--------------------FLEGQTYSAGGDYSLADIAFL 161
Fly 162 ATVSTFDVAG-----FDF-KRYANVARWYENA 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 18/67 (27%) |
PLN02473 | 3..196 | CDD:166114 | 53/227 (23%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 32/145 (22%) | ||
CLIC2 | NP_001280.3 | Required for insertion into the membrane. /evidence=ECO:0000250 | 1..96 | 23/87 (26%) | |
N-terminal | 1..94 | 22/85 (26%) | |||
O-ClC | 12..245 | CDD:129941 | 53/227 (23%) | ||
Joint loop | 95..106 | 1/10 (10%) | |||
C-terminal | 107..247 | 29/128 (23%) | |||
Foot loop | 151..171 | 2/19 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154395 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |