DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Clic1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:228 Identity:48/228 - (21%)
Similarity:81/228 - (35%) Gaps:63/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGS-----APC---RSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLH 57
            ::|:.:.||     ..|   :.:.|.....||.|: .|.::|:.|   |....|:.|...:|   
Mouse     8 VELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFN-VTTVDTKRR---TETVQKLCPGGQLP--- 65

  Fly    58 DHGFALWESRAIMVYLVEKYGKDDK--------LFPKDVQKQALINQRLYFDMGTLYKSFSEYYY 114
                       .::|..|.:...:|        |.|....|.|.:|.........::..||.|  
Mouse    66 -----------FLLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAY-- 117

  Fly   115 PQIFLKKPANEENYKK-IEVAFEFLNTFL---------------EG---QTYSAGGDYSLADIAF 160
              |....||..:|.:| :..|.:.|:.:|               ||   :.:..|.:.:|||...
Mouse   118 --IKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNL 180

  Fly   161 LATVSTFDVA-----GFDF-KRYANVARWYENA 187
            |..:....|.     ||.. :.:..|.|:..||
Mouse   181 LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 16/81 (20%)
PLN02473 3..196 CDD:166114 48/226 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/124 (23%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 19/99 (19%)
O-ClC 6..241 CDD:129941 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.