DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF101

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_149981.2 Gene:ZNF101 / 94039 HGNCID:12881 Length:436 Species:Homo sapiens


Alignment Length:151 Identity:52/151 - (34%)
Similarity:82/151 - (54%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 IERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQG 311
            |....|::..:  |::||::.:..|:...|...|:|.|.:.||:|.|.|.....:..|:| .|.|
Human   273 IRSHALEKSHQ--CQECGKKLSCSSSLHRHERTHSGGKLYECQKCAKVFRCPTSLQAHER-AHTG 334

  Fly   312 EKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTIC 376
            |:||:|..|.|:|:..:....|::||:..|||.|..|.|.|...|..:|||:.|||.:.|.|..|
Human   335 ERPYECNKCGKTFNYPSCFRRHKKTHSGEKPYECTRCGKAFGWCSSLRRHEMTHTGEKPFDCKQC 399

  Fly   377 KQSFQRNTHLKAHLRSKFHTA 397
            .:.|..:.:|:.|.|:  |.|
Human   400 GKVFTFSNYLRLHERT--HLA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
zf-H2C2_2 272..297 CDD:290200 9/24 (38%)
C2H2 Zn finger 288..309 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
C2H2 Zn finger 345..365 CDD:275368 8/19 (42%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)
ZNF101NP_149981.2 KRAB 4..>46 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 104..124 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..164
lambda-1 149..>209 CDD:212564
C2H2 Zn finger 171..191 CDD:275368
COG5048 <176..357 CDD:227381 26/86 (30%)
C2H2 Zn finger 199..219 CDD:275368
C2H2 Zn finger 227..247 CDD:275368
zf-H2C2_2 240..264 CDD:290200
C2H2 Zn finger 255..276 CDD:275368 1/2 (50%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
C2H2 Zn finger 312..332 CDD:275368 7/20 (35%)
zf-H2C2_2 324..349 CDD:290200 11/25 (44%)
COG5048 336..>407 CDD:227381 27/70 (39%)
C2H2 Zn finger 340..360 CDD:275368 5/19 (26%)
zf-H2C2_2 353..375 CDD:290200 9/21 (43%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
zf-H2C2_2 380..404 CDD:290200 9/23 (39%)
C2H2 Zn finger 396..416 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.