DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and AZF1

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:78/331 - (23%)
Similarity:126/331 - (38%) Gaps:95/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DHDSDAHHDLDEDNYIDSV--EDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSN---- 179
            ::::|.::| :.||.|:|.  .::...:|.:..:.:.:.:....:..:::.|....||:.|    
Yeast   374 ENNNDNNND-NNDNSINSATSTNIPNQEDHSLASTDTTSNSRKDLKEIEQRLRKHLNDEDNYSSA 437

  Fly   180 ----SDNNDYMEPQNGSYFNETINE------------------YEVSSNPNTPLPESK----SAA 218
                .|.||.:|...|  .|:.|:|                  |..:..|.|..|.||    ||.
Yeast   438 ISRPLDKNDVIEGSEG--LNKHIDESGMQPNIIKKRKKDDSTVYVKNEMPRTDPPMSKDNSTSAE 500

  Fly   219 GRS-----------------TKPAT-----TK--------PKRKKQYVTWKNMTEE--------- 244
            |.:                 :..||     ||        ..|||.:....|.|::         
Yeast   501 GAAMANFSGKEPPIPDISSVSDDATNLIGATKVDQLMLIIQARKKGFTEKVNTTQDGDLLFNQTM 565

  Fly   245 -------QII---------ERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGK 293
                   :::         :..|..:|.|  |..|.|.|:..::.::|:..|.|.|.|.|..|||
Yeast   566 DILPPKSELVGGVEKPKGTQNTRAVKKHE--CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGK 628

  Fly   294 RFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSC--HHCDKCFKSAS 356
            ||.....:..|:| :|.|||||.|..|.|.|........|..||...||:.|  .:|:|.|....
Yeast   629 RFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLG 692

  Fly   357 GRKRHE 362
            ..|.|:
Yeast   693 NMKAHQ 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
C2H2 Zn finger 345..365 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..391 CDD:275368
AZF1NP_014756.3 COG5048 342..768 CDD:227381 78/331 (24%)
C2H2 Zn finger 595..615 CDD:275368 5/19 (26%)
C2H2 Zn finger 623..643 CDD:275368 8/20 (40%)
C2H2 Zn finger 651..671 CDD:275368 5/19 (26%)
C2H2 Zn finger 679..702 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.