DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and TT1

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:255 Identity:59/255 - (23%)
Similarity:87/255 - (34%) Gaps:68/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 NDDSNSDNND---YMEPQNGSYFNETINEYEVSSNPNTPLP-------ESKSAAGRSTKPATTKP 229
            |.:||.|.|.   |.|........|...:.||..:.:..||       ::|....|:.|...|..
plant    52 NLNSNLDLNPNPLYAEEGEQEEEEEEEEDREVDVDLHIGLPGFGKPSNDAKQLKKRNGKEIATYD 116

  Fly   230 KRK--------KQYVTWKNMTEEQIIERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNK-- 284
            ..|        |.|  |....|:.:|......      |..|.:.|...:|.::||..| |::  
plant   117 AGKGIENELSGKAY--WIPAPEQILIGFTHFS------CHVCFKTFNRYNNLQMHMWGH-GSQYR 172

  Fly   285 ---------------NFACQQC--GKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLI 332
                           ...|..|  |.|.:.|          |...||      .|.|....|.  
plant   173 KGPESLKGTQPRAMLGIPCYCCVEGCRNHID----------HPRSKP------LKDFRTLQTH-- 219

  Fly   333 HERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRS 392
            ::|.|.: ||:||..|.|........:.||. :.|.| :.| :|...|:....||.|:::
plant   220 YKRKHGH-KPFSCRLCGKLLAVKGDWRTHEK-NCGKR-WVC-VCGSDFKHKRSLKDHVKA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 9/43 (21%)
C2H2 Zn finger 288..309 CDD:275368 5/22 (23%)
C2H2 Zn finger 317..337 CDD:275368 4/19 (21%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
C2H2 Zn finger 257..274 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.