DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZKSCAN3

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001229823.1 Gene:ZKSCAN3 / 80317 HGNCID:13853 Length:538 Species:Homo sapiens


Alignment Length:376 Identity:99/376 - (26%)
Similarity:150/376 - (39%) Gaps:104/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CCTLDL------NQAILFRERCILTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEY 111
            ||.:.|      :|:..|:    |.:..|.|              |.:.|.|         :.:.
Human   146 CCKMALLTPAPGSQSSQFQ----LMKALLKH--------------ESVGSQP---------LQDR 183

  Fly   112 IVESPEEVLDHDSDAHHD-------LDEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKE 169
            :::.|  ||.|......|       ..|...:..|||| ||....|..::||..           
Human   184 VLQVP--VLAHGGCCREDKVVASRLTPESQGLLKVEDV-ALTLTPEWTQQDSSQ----------- 234

  Fly   170 LESICNDDSNSDNNDYMEPQNGSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRK-- 232
             .::|.|:...::...:.                       |.:.|....|...||...|:::  
Human   235 -GNLCRDEKQENHGSLVS-----------------------LGDEKQTKSRDLPPAEELPEKEHG 275

  Fly   233 ----------KQYVTWKNMTEEQIIERKRLQRK-------RECVCEQCGRQFTDQSNFKLHMLRH 280
                      .|..|.....|::    .|||||       |..:|.:||:.|...|....|...|
Human   276 KISCHLREDIAQIPTCAEAGEQE----GRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIH 336

  Fly   281 TGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSC 345
            ||.|.:.|::|||.|.....:.:||| :|.|||||:|..|.|:|.:|:..:.|:||||..|||.|
Human   337 TGEKPYECEECGKAFIGSSALVIHQR-VHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYEC 400

  Fly   346 HHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRSKFHT 396
            ..|.|.|..:.....|..||||.:.:.|::|.::|:|::||..|.|  .||
Human   401 DDCGKTFSQSCSLLEHHRIHTGEKPYQCSMCGKAFRRSSHLLRHQR--IHT 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 6/27 (22%)
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)
ZKSCAN3NP_001229823.1 SCAN 42..154 CDD:128708 3/7 (43%)
SCAN 42..130 CDD:280241
KRAB 214..274 CDD:214630 17/95 (18%)
KRAB 217..252 CDD:279668 10/70 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..274 11/82 (13%)
zf-C2H2 314..336 CDD:278523 6/21 (29%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 329..351 CDD:290200 9/21 (43%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
zf-H2C2_2 356..381 CDD:290200 13/25 (52%)
COG5048 <368..515 CDD:227381 35/84 (42%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 384..409 CDD:290200 12/24 (50%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
zf-H2C2_2 412..437 CDD:290200 8/24 (33%)
C2H2 Zn finger 428..448 CDD:275368 8/21 (38%)
zf-C2H2 480..502 CDD:278523
C2H2 Zn finger 482..502 CDD:275368
zf-H2C2_2 495..519 CDD:290200
C2H2 Zn finger 510..530 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.