DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF154

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001078853.1 Gene:ZNF154 / 7710 HGNCID:12939 Length:437 Species:Homo sapiens


Alignment Length:132 Identity:51/132 - (38%)
Similarity:73/132 - (55%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSF 324
            |.:||:.|:..|:...|...|||.:.:.|.:|||.| :.....|..|.:|.||:||:|..|.|.|
Human   303 CSECGKSFSQNSSLIEHHRVHTGERPYKCSECGKSF-SQRSALLQHRGVHTGERPYECSECGKFF 366

  Fly   325 HNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAH 389
            ..|::...|:|.||.::||.|..|.|.|...||..:|..:|||.:.:.||.|.:||..|:.|..|
Human   367 PYSSSLRKHQRVHTGSRPYECSECGKSFTQNSGLIKHRRVHTGEKPYECTECGKSFSHNSSLIKH 431

  Fly   390 LR 391
            .|
Human   432 QR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 9/24 (38%)
C2H2 Zn finger 288..309 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 7/19 (37%)
C2H2 Zn finger 373..391 CDD:275368 8/17 (47%)
ZNF154NP_001078853.1 KRAB 14..>62 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..129
C2H2 Zn finger 135..155 CDD:275368
COG5048 139..>436 CDD:227381 51/132 (39%)
C2H2 Zn finger 163..183 CDD:275368
C2H2 Zn finger 191..211 CDD:275368
C2H2 Zn finger 219..239 CDD:275368
zf-H2C2_2 231..256 CDD:290200
C2H2 Zn finger 247..267 CDD:275368
C2H2 Zn finger 275..295 CDD:275368
zf-H2C2_2 287..312 CDD:290200 4/8 (50%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-H2C2_2 315..340 CDD:290200 9/25 (36%)
C2H2 Zn finger 331..351 CDD:275368 7/20 (35%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
zf-H2C2_2 371..396 CDD:290200 10/24 (42%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 400..424 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.