DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZSCAN21

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001349708.1 Gene:ZSCAN21 / 7589 HGNCID:13104 Length:473 Species:Homo sapiens


Alignment Length:407 Identity:119/407 - (29%)
Similarity:169/407 - (41%) Gaps:82/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HNDP---ELPSSICACCTLDLNQAILFRER-----------CILTQK-QLVHRRRSPEAKEPA-- 88
            |:.|   |..|.:...|...|...|..:|:           .||.|: |...:...||:.|.|  
Human    54 HDTPGPREALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVT 118

  Fly    89 --EDVE-EMASPPDCLNDPFGE---VDEYI------VESPEEVLDHDSDAHHDLDE--DNYI-DS 138
              ||:| |:..|...::.|..|   |.|.|      .|||..:.....:..|..:.  ..|| :|
Human   119 LLEDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQES 183

  Fly   139 VEDVDALQDMAEVAE--EDSQDVESLISSVQKELESICND-----DSNSDNNDYMEPQNGSYFNE 196
            .|:.:..||..:|.:  ..:|..||.......|.|.:..|     .:|       :|: .|...:
Human   184 GEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIAN-------KPE-ASLERQ 240

  Fly   197 TIN-EYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECVC 260
            .:| |.|..:.|  ||.|:.|..||.:.|  |||                      ...:|..:|
Human   241 CVNLENEKGTKP--PLQEAGSKKGRESVP--TKP----------------------TPGERRYIC 279

  Fly   261 EQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFH 325
            .:||:.|::.||...|...|||.|.:.|.:|||.|.....:|||.| .|..::||||: |.|:|.
Human   280 AECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYR-THLVDRPYDCK-CGKAFG 342

  Fly   326 NSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHL 390
            .|:..|.|:|.||...||.|..|.|.|.......||..||||.:.:.|..|.:||.::..|.:|.
Human   343 QSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQ 407

  Fly   391 RSKFHTA----KAKTIG 403
            |  .||.    |.|..|
Human   408 R--LHTGEKPYKCKECG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 11/48 (23%)
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
ZSCAN21NP_001349708.1 SCAN 42..153 CDD:128708 26/98 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..169 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..272 13/53 (25%)
COG5048 <276..453 CDD:227381 58/151 (38%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 307..327 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..354 CDD:275368 7/16 (44%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
C2H2 Zn finger 390..410 CDD:275368 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 2/5 (40%)
C2H2 Zn finger 446..466 CDD:275368
zf-C2H2 446..466 CDD:395048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.