DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZKSCAN1

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001333510.1 Gene:ZKSCAN1 / 7586 HGNCID:13101 Length:563 Species:Homo sapiens


Alignment Length:417 Identity:105/417 - (25%)
Similarity:161/417 - (38%) Gaps:127/417 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PEAKEPA----EDVE---------------EMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAH 127
            |::.|.|    ||:|               ||.:......||..|...:             |.|
Human   121 PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSF-------------DLH 172

  Fly   128 HDLDEDNYIDSVEDVDALQDMA-----------EVAEEDSQDVESLISSVQKELESI-------- 173
            |:..:.::..|......||..|           |.:..|.....:|.::..:.:..|        
Human   173 HEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLI 237

  Fly   174 -----CND--------DSNSDNNDYMEPQNGSYFNETINEYEVSSNPNTPLPESKS---AAGRST 222
                 |.:        |:..:|.....||.|    |..||.|.|::......:|.|   ..|||.
Human   238 LEEWGCQNLARRNLSRDNRQENYGSAFPQGG----ENRNENEESTSKAETSEDSASRGETTGRSQ 298

  Fly   223 K---------------------PATTKPKR--------KKQYVTWKN------------------ 240
            |                     ..|.|.||        .|:.:|.:.                  
Human   299 KEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSN 363

  Fly   241 -MTEEQIIERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLH 304
             .|.|::....:..|     |::||:.||..|:...|.:.|||.|.:.|.:|||.|..:..:.||
Human   364 FTTPEEVPTGTKSHR-----CDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNLVLH 423

  Fly   305 QRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVR 369
            || ||.||||::|..|.|:|.:|:..::|:|.|:..|||.|:.|.|.|..:|...:|:.||||.:
Human   424 QR-IHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEK 487

  Fly   370 AFACTICKQSFQRNTHLKAHLRSKFHT 396
            .:.|:.|.::|.||::|..|.|  .||
Human   488 PYECSECGKAFNRNSYLILHRR--IHT 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)
ZKSCAN1NP_001333510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
SCAN 52..162 CDD:128708 8/40 (20%)
KRAB_A-box 227..262 CDD:143639 4/34 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..373 23/119 (19%)
C2H2 Zn finger 355..371 CDD:275368 2/15 (13%)
COG5048 <356..537 CDD:227381 60/165 (36%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 407..427 CDD:275368 9/20 (45%)
C2H2 Zn finger 435..455 CDD:275368 7/19 (37%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
C2H2 Zn finger 491..511 CDD:275368 8/21 (38%)
C2H2 Zn finger 519..539 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.