DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF649

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_075562.2 Gene:ZNF649 / 65251 HGNCID:25741 Length:505 Species:Homo sapiens


Alignment Length:341 Identity:90/341 - (26%)
Similarity:141/341 - (41%) Gaps:72/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SPEAKEPAED-----------VEEMASPPDCL-----NDPFGEVDEYIVESPEEVLDHDSDAHHD 129
            ||..|:...|           |...|..||.|     .:|...:::.|          .|.||.:
Human    26 SPAQKDLYRDVMLENYSNLVSVGYQAGKPDALTKLEQGEPLWTLEDEI----------HSPAHPE 80

  Fly   130 LDE-DNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNNDYMEPQ---- 189
            ::: |:::.     ..||:. ::.:...|..|.     .:.|:|.....:.|...:..||.    
Human    81 IEKADDHLQ-----QPLQNQ-KILKRTGQRYEH-----GRTLKSYLGLTNQSRRYNRKEPAEFNG 134

  Fly   190 NGSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQR 254
            :|::.::  |..::.:  ....|||:       ||.:||.:..|...|            ..:::
Human   135 DGAFLHD--NHEQMPT--EIEFPESR-------KPISTKSQFLKHQQT------------HNIEK 176

  Fly   255 KRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRF 319
            ..||.  .||:.|..:|....|...|||.|...|..|||.||..:.:|.|:| .|:||||:.|..
Human   177 AHECT--DCGKAFLKKSQLTEHKRIHTGKKPHVCSLCGKAFYKKYRLTEHER-AHRGEKPHGCSL 238

  Fly   320 CTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNT 384
            |.|:|:.......|||.|...|||.|..|.|.|...|....|:.||||::...|:.|.::|.|.:
Human   239 CGKAFYKRYRLTEHERAHKGEKPYGCSECGKAFPRKSELTEHQRIHTGIKPHQCSECGRAFSRKS 303

  Fly   385 ----HLKAHLRSKFHT 396
                |.:.|...|.||
Human   304 LLVVHQRTHTGEKPHT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/21 (29%)
ZNF649NP_075562.2 KRAB 8..68 CDD:214630 10/41 (24%)
KRAB 8..47 CDD:279668 4/20 (20%)
C2H2 Zn finger 180..200 CDD:275368 6/21 (29%)
zf-H2C2_2 193..215 CDD:290200 9/21 (43%)
C2H2 Zn finger 208..228 CDD:275368 9/20 (45%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
COG5048 260..>321 CDD:227381 22/60 (37%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 276..301 CDD:290200 8/24 (33%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
zf-H2C2_2 305..329 CDD:290200 5/15 (33%)
C2H2 Zn finger 320..340 CDD:275368 90/341 (26%)
zf-H2C2_2 332..357 CDD:290200
C2H2 Zn finger 348..368 CDD:275368
C2H2 Zn finger 376..396 CDD:275368
zf-H2C2_2 389..413 CDD:290200
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.