DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and GZF1

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001303941.1 Gene:GZF1 / 64412 HGNCID:15808 Length:711 Species:Homo sapiens


Alignment Length:157 Identity:52/157 - (33%)
Similarity:72/157 - (45%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRI----------------- 307
            |.:||.:|:..|..|.||..|||.|.|.|.:||.||..:|::..|:|.                 
Human   437 CTECGARFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHTGERPFMCETCGKSFA 501

  Fly   308 ----------IHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHE 362
                      ||.|.||:.|..|.::|...|:...|.:.||..:||.|..|.|.|...:..:||.
Human   502 SKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLNALQRHR 566

  Fly   363 LIHTGVRAFACTICKQSFQRNTHLKAH 389
            .||||.|.|.|..|.::|...:.|:.|
Human   567 RIHTGERPFMCNACGRTFTDKSTLRRH 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 13/24 (54%)
C2H2 Zn finger 288..309 CDD:275368 8/47 (17%)
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)
GZF1NP_001303941.1 BTB 21..133 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..220
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..312
C2H2 Zn finger 319..339 CDD:275368
C2H2 Zn finger 350..371 CDD:275368
COG5048 <405..593 CDD:227381 51/155 (33%)
C2H2 Zn finger 409..429 CDD:275368
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
C2H2 Zn finger 465..485 CDD:275368 8/19 (42%)
C2H2 Zn finger 493..513 CDD:275368 0/19 (0%)
C2H2 Zn finger 521..541 CDD:275368 5/19 (26%)
C2H2 Zn finger 549..569 CDD:275368 6/19 (32%)
C2H2 Zn finger 577..597 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.