DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZSCAN32

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:386 Identity:108/386 - (27%)
Similarity:162/386 - (41%) Gaps:84/386 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ERCILTQKQL------VHRRRSPEAKEPAEDVEEM-------ASPPDCLNDPF----------GE 107
            |:|....|.|      |.|.|.|   ||....|||       ||.|...:|..          ||
Human   304 EQCRTKFKSLQLSYRKVRRGRVP---EPCIFYEEMNALSGSWASAPPMASDAVPGQEGSDIEAGE 365

  Fly   108 VDEYIVESPEEVLDHDSDAHHDLDEDNYIDSVEDVDALQDMA-------------EVAEE----- 154
            ::....| |.||.|...|. .|.||.::.:..::|..| |:.             |:.:|     
Human   366 LNHQNGE-PTEVEDGTVDG-ADRDEKDFRNPGQEVRKL-DLPVLFPNRLGFEFKNEIKKENLKWD 427

  Fly   155 DSQDVESLISSVQKELESICNDDSNSDNNDYMEPQNGSYFNETINEYEVSSNPNTPLPESKSAAG 219
            ||::||     :.|.|:               ....|.|::..:.: .:.|.| |...:.:::.|
Human   428 DSEEVE-----INKALQ---------------RKSRGVYWHSELQK-GLESEP-TSRRQCRNSPG 470

  Fly   220 RSTKPATTKPKRKKQ-----------YVTWKNMTEEQIIERK-RLQRKRECVCEQCGRQFTDQSN 272
            .|.:...::.|...|           .:..||.::......| .|:.::...|.:||:.|:..|.
Human   471 ESEEKTPSQEKMSHQSFCARDKACTHILCGKNCSQSVHSPHKPALKLEKVSQCPECGKTFSRSSY 535

  Fly   273 FKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTH 337
            ...|...|||.|...|.:|||.|.....:|.|.| .|.||:||.|..|.|||:.|::.::|:|||
Human   536 LVRHQRIHTGEKPHKCSECGKGFSERSNLTAHLR-THTGERPYQCGQCGKSFNQSSSLIVHQRTH 599

  Fly   338 TNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRSKFHTAK 398
            |..|||.|..|.|.|.::|....|..||||...:.|.:|.:.|..::|..||  .|.||.:
Human   600 TGEKPYQCIVCGKRFNNSSQFSAHRRIHTGESPYKCAVCGKIFNNSSHFSAH--RKTHTGE 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 3/8 (38%)
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395 12/49 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 5/32 (16%)
COG5048 <455..668 CDD:227381 67/208 (32%)
zf-C2H2 522..543 CDD:278523 6/20 (30%)
C2H2 Zn finger 523..543 CDD:275368 6/19 (32%)
zf-H2C2_2 535..559 CDD:290200 9/23 (39%)
C2H2 Zn finger 551..571 CDD:275368 8/20 (40%)
zf-H2C2_2 563..588 CDD:290200 13/25 (52%)
C2H2 Zn finger 579..599 CDD:275368 8/19 (42%)
zf-H2C2_2 591..616 CDD:290200 12/24 (50%)
C2H2 Zn finger 607..627 CDD:275368 6/19 (32%)
zf-H2C2_2 623..644 CDD:290200 8/20 (40%)
C2H2 Zn finger 635..655 CDD:275368 7/21 (33%)
zf-H2C2_2 647..671 CDD:290200 6/14 (43%)
zf-C2H2 661..683 CDD:278523
C2H2 Zn finger 663..683 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.