DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF562

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001123503.1 Gene:ZNF562 / 54811 HGNCID:25950 Length:426 Species:Homo sapiens


Alignment Length:204 Identity:64/204 - (31%)
Similarity:95/204 - (46%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKR-KKQYVTWKNMTEEQIIERKRLQR 254
            |.:..|.:.|::......|.....|......|...:.|.|. .|.:..:..::    ...|..:.
Human   224 GIHIGEKLCEFQECERAITTSSHLKQCVAVHTGKKSEKTKNCGKSFTNFSQLS----AHAKTHKG 284

  Fly   255 KRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRF 319
            ::...|::|||.|.:.|:|.:|:..|||.|...|.:|||.|.....:|.|.| .|.|.|||:|:.
Human   285 EKSFECKECGRSFRNSSSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVR-THTGIKPYECKE 348

  Fly   320 CTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSF---- 380
            |.::|.......||.|.||..|||.|..|.|.|..:|...:|..||||.:.:.|..|.::|    
Human   349 CGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSS 413

  Fly   381 QRNTHLKAH 389
            .|:.|||.|
Human   414 HRSKHLKTH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 8/21 (38%)
ZNF562NP_001123503.1 KRAB 40..81 CDD:307490
COG5048 <117..308 CDD:227381 18/87 (21%)
C2H2 Zn finger 181..198 CDD:275370
C2H2 Zn finger 206..226 CDD:275368 1/1 (100%)
COG5048 <258..420 CDD:227381 55/166 (33%)
C2H2 Zn finger 263..282 CDD:275368 3/22 (14%)
C2H2 Zn finger 290..310 CDD:275368 8/19 (42%)
C2H2 Zn finger 318..338 CDD:275368 8/20 (40%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
C2H2 Zn finger 374..394 CDD:275368 6/19 (32%)
C2H2 Zn finger 402..422 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.