DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and CG4936

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:479 Identity:123/479 - (25%)
Similarity:185/479 - (38%) Gaps:105/479 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGSIIYNKMPK----NLFHIENEKMLQD-INLVTGTTLHNDPELPSSICACCTLDLNQAILF 64
            ||.|     .:.||    ::|:.::||.|.. |....|..:......|..||..|...|..|..|
  Fly    23 CRVC-----LQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKF 82

  Fly    65 RERCILTQKQLVHRR----------RSPEAK--------EPAEDVEEMASPPDCLNDPFGE---V 108
            ||.|   |:...|.|          |.||.|        ||..|.:|....|:  :|...|   :
  Fly    83 RETC---QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPE--HDEEDEDVDL 142

  Fly   109 DEYIVESPEEVLDHDSDAHHD----------------------LDEDNYIDSVEDV------DAL 145
            ||......::..:......||                      ::||..|:.|.||      |.:
  Fly   143 DESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLI 207

  Fly   146 QD------MAEVA-EEDSQDVESLISSVQKEL-ESICNDDS----NSDNNDYMEPQNGSYFNETI 198
            .|      ||:.| .|.|.::|.|......:| ||...||:    ||...:::..::........
  Fly   208 PDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHAR 272

  Fly   199 NEYEVSSNPNTPLPESKSAAGRSTKPATT------KPKR--------KKQYVTWKNMTEEQIIER 249
            |..:...||......:.|.|..|:...||      |.:|        |....:.|:::..:::.|
  Fly   273 NATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLAR 337

  Fly   250 KR------------LQRKRE--CVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHL 300
            |.            |..|:|  .:|:.||..:..||....|:..|:|.|...|:.||..|.....
  Fly   338 KHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQ 402

  Fly   301 MTLHQRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIH 365
            :..|.. .|.|.:||.|.:|..:|.:.:||..|.|.|||.:||.|..|.|.|...:..|.|::||
  Fly   403 LARHMN-THTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIH 466

  Fly   366 TGVRAFACTICKQSFQRNTHLKAH 389
            ||.:...|.:|.:.|.:...|:.|
  Fly   467 TGEKPHVCDVCGKGFPQAYKLRNH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 22/74 (30%)
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 8/24 (33%)
C2H2 Zn finger 288..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 23/79 (29%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 22/61 (36%)
C2H2 Zn finger 390..410 CDD:275368 5/20 (25%)
zf-H2C2_2 403..426 CDD:290200 7/23 (30%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 8/21 (38%)
C2H2 Zn finger 474..494 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.