DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and CG6654

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:583 Identity:113/583 - (19%)
Similarity:188/583 - (32%) Gaps:211/583 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTC----GSIIYNKMPKNLFHIENEKMLQD-INLVTGTTLHNDPELPSSICACCTLDLNQAILF 64
            |.||    |.::      :::...:...|.| |...|.|....:..||..:|..|..:::....|
  Fly     7 CLTCLSSTGPLL------SIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTF 65

  Fly    65 RERCILTQKQLVHRRRSPEAKEPAEDVEEMASPP------------------------DCLNDPF 105
            :.:|..:.:.|  |:..|.|.....|.:...|.|                        |.:....
  Fly    66 KIKCENSSRTL--RQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTD 128

  Fly   106 GEVDEYIVESPEEV-LDHDSDAH---HDLDEDNYIDSVEDVDA--------LQDMAEVA------ 152
            .|.:..:::|...| ||::.:..   ::|.:    :.||...:        |:|..||.      
  Fly   129 AEQNTSLIKSTISVDLDYEGEGEVFDYELPD----EPVEKTTSLILQVQGNLKDEKEVVFTQTNV 189

  Fly   153 --EEDSQDVE--------SLISSVQKELE-------------SICNDDSNSDNNDYMEPQNGSYF 194
              |.|..::|        ::...|..|.|             |.....:..:|:.:..|. ||  
  Fly   190 IYEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPV-GS-- 251

  Fly   195 NETINEYEVSSNPNT------------------------PLPE----------SKSAAGRSTKPA 225
            .|...|.|....|.:                        |.|:          |...||....|:
  Fly   252 KEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPS 316

  Fly   226 TTK-----PKRK------------------------------------KQYVTWKNMTEEQ---- 245
            ||.     |:.|                                    |.:|:..::.|.|    
  Fly   317 TTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHG 381

  Fly   246 --------------------IIERKRLQRKREC--------------------------VCEQCG 264
                                :::..:...:.:|                          ||..||
  Fly   382 AHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICG 446

  Fly   265 RQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHNSNT 329
            :.||..:|.:.|.|||:..|:|.|:.|...|.|...:|.|.| .|.|:||::|..|...|..|.:
  Fly   447 KSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHAR-THTGDKPFECEVCLARFTTSCS 510

  Fly   330 RLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRS 392
            ...|:|.||..:||:|..|...|.:.:..|.|...|||.|.:.|..|.::|.:....:.|.|:
  Fly   511 LAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRT 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 15/74 (20%)
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 4/17 (24%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 17/79 (22%)
C2H2 Zn finger 331..354 CDD:275368 0/22 (0%)
COG5048 <357..570 CDD:227381 51/213 (24%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
C2H2 Zn finger 385..406 CDD:275370 0/20 (0%)
C2H2 Zn finger 414..434 CDD:275368 1/19 (5%)
zf-H2C2_2 427..451 CDD:290200 5/23 (22%)
C2H2 Zn finger 442..490 CDD:275368 19/48 (40%)
C2H2 Zn finger 470..487 CDD:275368 5/16 (31%)
zf-H2C2_2 482..507 CDD:290200 10/25 (40%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 8/23 (35%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..574 CDD:275368 5/20 (25%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.