DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and CG6813

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:402 Identity:113/402 - (28%)
Similarity:157/402 - (39%) Gaps:120/402 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQCRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFRER 67
            |.||.|..   :..|.:||...|..:::.|:.:||..|....|:...:|..|..:|..||.||:|
  Fly     4 LNCRICSR---SDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQR 65

  Fly    68 CILTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAHHDLDE 132
            ||:.:||.:.|            :|  ....||..||.                    .:.|:| 
  Fly    66 CIIAEKQNLER------------IE--CDSKDCSTDPI--------------------IYEDID- 95

  Fly   133 DNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNNDYMEPQNGSYFNET 197
            ||.|:|..|                  ||::....|:|                 |...:     
  Fly    96 DNQIESELD------------------ESILCPEVKDL-----------------PMPSA----- 120

  Fly   198 INEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECVCEQ 262
                |..|.| |.|...||..| .|.|                                 .||..
  Fly   121 ----EKVSAP-TSLNHQKSIGG-GTGP---------------------------------YVCPD 146

  Fly   263 CGRQFTDQSNFKLHMLRHTGNKNFAC--QQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFH 325
            |||...::|||:.|.|||||.|||.|  ..|.:.|.|...:|.|.| ||.||:||.|.:|.:.|.
  Fly   147 CGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTR-IHTGEQPYVCVYCPRRFS 210

  Fly   326 NSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHL 390
            :|..|..|.|.|.|.:.|.|..|.|.|.|:...::|::||...|...|.:|::.|:|.:||..||
  Fly   211 SSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHL 275

  Fly   391 RSKFHTAKAKTI 402
            .|..|..|.:.:
  Fly   276 SSNIHKRKEEKL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 23/70 (33%)
C2H2 Zn finger 260..280 CDD:275368 9/19 (47%)
zf-H2C2_2 272..297 CDD:290200 14/26 (54%)
C2H2 Zn finger 288..309 CDD:275368 7/22 (32%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 24/72 (33%)
C2H2 Zn finger 144..164 CDD:275368 9/19 (47%)
C2H2 Zn finger 172..194 CDD:275368 7/22 (32%)
zf-H2C2_2 186..211 CDD:290200 12/25 (48%)
UFD2 <256..>294 CDD:227443 11/32 (34%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.