DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and Zif

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:408 Identity:101/408 - (24%)
Similarity:163/408 - (39%) Gaps:75/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGSIIYNKMPKNLFHIENE------KMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAIL 63
            ||.|  :..::..:.|..|..|      :||..:..|:.:.|::...:|..||..|.::||.|..
  Fly    10 CRVC--LAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQ 72

  Fly    64 FRERCILTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEY------IVESPEEVLDH 122
            |||:.:  :||:                               |::||      :.||...::..
  Fly    73 FREKAL--RKQM-------------------------------EIEEYCRELGLLDESDVMMIKE 104

  Fly   123 DSDAHHDLDEDNYI-----DSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDN 182
            :..:....||:.||     ...|:....:...|..|.|:.|.:..|....:.||.....:.|||.
  Fly   105 EDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQ 169

  Fly   183 NDYMEPQNGSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQII 247
            .:.:        .|:..:||.:.:....|.|   ||..|.|....:.:|....:|..:.||    
  Fly   170 TEIV--------LESEKQYEETPSQQLALQE---AAKASLKARRGRVRRGLNSLTTSDGTE---- 219

  Fly   248 ERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGE 312
                   |...:|:.||..:..:.....|..||.|...:||:.|..:|.....:..|. ..|.|.
  Fly   220 -------KGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHM-YSHTGS 276

  Fly   313 KPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICK 377
            |||.|.||::.|...:....||..|...|||.|..|||.|..|....:|||||:.::.:.|..|.
  Fly   277 KPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCN 341

  Fly   378 QSFQRNTHLKAHLRSKFH 395
            :.|:...|::.|..:|.|
  Fly   342 KDFRLLHHMRQHEETKLH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 21/75 (28%)
C2H2 Zn finger 260..280 CDD:275368 4/19 (21%)
zf-H2C2_2 272..297 CDD:290200 8/24 (33%)
C2H2 Zn finger 288..309 CDD:275368 4/20 (20%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 9/19 (47%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 23/111 (21%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 38/111 (34%)
C2H2 Zn finger 253..273 CDD:275368 4/20 (20%)
zf-H2C2_2 266..288 CDD:290200 9/22 (41%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.