DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF621

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001091884.1 Gene:ZNF621 / 285268 HGNCID:24787 Length:439 Species:Homo sapiens


Alignment Length:199 Identity:56/199 - (28%)
Similarity:82/199 - (41%) Gaps:59/199 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 CEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYT---------DHL--------------- 300
            |::||:.|...|....|.:.|||.|.|.|::|||.|.:         :|:               
Human   153 CKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLS 217

  Fly   301 ----MTLHQRIIHQGEKPYDCRFCTKSFHNSNTRL----------------------------IH 333
                :|.||| ||.|||||:|:.|.|:|..|...|                            :|
Human   218 SNTALTQHQR-IHTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVH 281

  Fly   334 ERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRSKFHTAK 398
            :|.||..|||.|..|.|.|.......:|:.:|||.:.:.|.:|.::|:.......|  .|.|..:
Human   282 QRIHTGEKPYQCKECGKAFTQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQH--QKLHPVE 344

  Fly   399 AKTI 402
            .|.:
Human   345 KKPV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 10/48 (21%)
C2H2 Zn finger 317..337 CDD:275368 8/47 (17%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 4/17 (24%)
ZNF621NP_001091884.1 KRAB 11..71 CDD:214630
COG4049 145..198 CDD:226535 16/44 (36%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
zf-H2C2_2 166..190 CDD:316026 11/23 (48%)
C2H2 Zn finger 209..229 CDD:275368 4/20 (20%)
zf-H2C2_2 221..246 CDD:316026 15/25 (60%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 2/19 (11%)
zf-H2C2_2 281..302 CDD:316026 11/20 (55%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
zf-H2C2_2 308..329 CDD:316026 6/20 (30%)
C2H2 Zn finger 321..341 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.