DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF844

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_016882153.1 Gene:ZNF844 / 284391 HGNCID:25932 Length:668 Species:Homo sapiens


Alignment Length:282 Identity:77/282 - (27%)
Similarity:129/282 - (45%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DALQDMAEVAEE-DSQDVESLISSVQKELESICND--DSNSDNNDYMEPQNGSYFNETINEYEVS 204
            :.|:::|.:.|: ..|::|....:.:..|.|:..:  |.|::.|...| .:....::|:|:   .
Human    37 ETLRNLASIGEKWKDQNIEDQYKNPRNNLRSLLGERVDENTEENHCGE-TSSQIPDDTLNK---K 97

  Fly   205 SNPNTPLPESK---------SAAGRSTKPATT-KPKRKKQYVTWKNMTEEQIIERKR-------- 251
            ::|.....||.         |:..|..:..|. ||...::|    .....:..:||:        
Human    98 TSPGVKSCESSVCGEVFVGHSSLNRHIRADTAHKPSEYQEY----GQEPYKCQQRKKAFRCHPSF 158

  Fly   252 -LQRKREC-----VCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQ 310
             :|.|...     .|::||:.|...|:.:.||:.|.|:..:.|:.|||......:..:|:| :|.
Human   159 QMQEKAHTGEKLYDCKECGKTFISHSSIQRHMIMHNGDGTYKCKFCGKACPCLSIYLIHER-VHT 222

  Fly   311 GEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTI 375
            |||||.|:.|.|:|..|.:..|||||||..|||.|..|.|.|.|.:....|...|||.:.:.|..
Human   223 GEKPYKCKQCGKAFSYSTSLQIHERTHTGEKPYECKECGKAFGSPNSLYEHRRTHTGEKPYECKQ 287

  Fly   376 CKQSFQ----RNTHLKAHLRSK 393
            |.::|:    ...|.:.|...|
Human   288 CGKAFRWFHSFQIHERTHSEEK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
zf-H2C2_2 272..297 CDD:290200 8/24 (33%)
C2H2 Zn finger 288..309 CDD:275368 6/20 (30%)
C2H2 Zn finger 317..337 CDD:275368 9/19 (47%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 5/21 (24%)
ZNF844XP_016882153.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.