DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF584

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_775819.1 Gene:ZNF584 / 201514 HGNCID:27318 Length:421 Species:Homo sapiens


Alignment Length:336 Identity:78/336 - (23%)
Similarity:127/336 - (37%) Gaps:100/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DEDNYIDSVEDVD-----------ALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNND 184
            ||.:::.|..||.           .|..:..| |::....|.|     |....|.:.|::|:...
Human    72 DEQSWVPSWVDVTPVSRAEARRGFGLDGLCRV-EDERAHPEHL-----KSYRVIQHQDTHSEGKP 130

  Fly   185 YMEPQNGSYFNE------------------------------TINEYEVSSNPNTPL--PESKSA 217
            ....::|:.|..                              .:.::.::.:...|.  |..:||
Human   131 RRHTEHGAAFPPGSSCGQQQEVHVAEKLFKCSDCGKVFLKAFALLDHLITHSEERPFRCPTGRSA 195

  Fly   218 AGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTG 282
            ..:|.                      .|..||....:...||.:||:.|:..|..:.|...|||
Human   196 FKKSA----------------------HINPRKIHTGETAHVCNECGKAFSYPSKLRKHQKVHTG 238

  Fly   283 NKNFACQQCGKRFYTDHLMTLHQRI---------------------------IHQGEKPYDCRFC 320
            .|.|.|..|||.|.....:.|||||                           :|.||:||:|..|
Human   239 IKPFKCSDCGKTFNRKDALVLHQRIHTGERPYECSKCGKTFSVLSTLIRHRKVHIGERPYECTEC 303

  Fly   321 TKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTH 385
            .|.|..:|:.::|:|.||..:|:.|..|.|.:.:.||..:|..:|||.|.:.|::|.::|...::
Human   304 GKFFKYNNSFILHQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTGERPYECSLCGKTFTTRSY 368

  Fly   386 LKAHLRSKFHT 396
            ...|  .:|||
Human   369 RNRH--QQFHT 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 10/47 (21%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 4/17 (24%)
ZNF584NP_775819.1 KRAB 17..77 CDD:214630 2/4 (50%)
KRAB 17..56 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..146 4/25 (16%)
C2H2 Zn finger 161..181 CDD:275368 0/19 (0%)
COG5048 <189..374 CDD:227381 58/208 (28%)
zf-C2H2 214..236 CDD:278523 7/21 (33%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
zf-H2C2_2 229..253 CDD:290200 11/23 (48%)
C2H2 Zn finger 244..264 CDD:275368 9/19 (47%)
zf-H2C2_2 256..280 CDD:290200 5/23 (22%)
C2H2 Zn finger 272..292 CDD:275368 0/19 (0%)
zf-H2C2_2 285..309 CDD:290200 9/23 (39%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
zf-H2C2_2 316..337 CDD:290200 8/20 (40%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
C2H2 Zn finger 356..376 CDD:275368 4/21 (19%)
zf-H2C2_2 370..393 CDD:290200 4/10 (40%)
C2H2 Zn finger 384..404 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.