DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18764 and blmp-1

DIOPT Version :9

Sequence 1:	NP_652712.2	Gene:	CG18764 / 59239	FlyBaseID:	FBgn0042205	Length:	409	Species:	Drosophila melanogaster
Sequence 2:	NP_001251370.1	Gene:	blmp-1 / 172917	WormBaseID:	WBGene00003847	Length:	817	Species:	Caenorhabditis elegans

Alignment Length:	139	Identity:	44/139 - (31%)
Similarity:	69/139 - (49%)	Gaps:	3/139 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 KRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRF-YTDHLMTLHQRIIHQGEKPYDCR 318
            |....|:.|.:.|...||.|:|:..|||.:.|.|:.|.|.| ...||...|  ::|.||:|:.|.
Worm   505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHH--LVHTGERPHRCD 567

  Fly   319 FCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRN 383
            .|.|.|.:::....|.|.|...|||:|..||..|......:.|:.:|...|.::|..|.:.:...
Worm   568 ICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISP 632

  Fly   384 THLKAHLRS 392
            :.|:.|.::
Worm   633 SGLRTHWKT 641

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18764	NP_652712.2	zf-AD	4..75	CDD:214871
		C2H2 Zn finger	260..280	CDD:275368	7/19 (37%)
		zf-H2C2_2	272..297	CDD:290200	11/25 (44%)
		C2H2 Zn finger	288..309	CDD:275368	7/21 (33%)
		C2H2 Zn finger	317..337	CDD:275368	6/19 (32%)
		C2H2 Zn finger	345..365	CDD:275368	5/19 (26%)
		C2H2 Zn finger	373..391	CDD:275368	4/17 (24%)
blmp-1	NP_001251370.1	SET	119..247	CDD:214614
		zf-C2H2	508..530	CDD:278523	7/21 (33%)
		C2H2 Zn finger	510..530	CDD:275368	7/19 (37%)
		zf-H2C2_2	522..547	CDD:290200	11/24 (46%)
		C2H2 Zn finger	538..558	CDD:275368	7/21 (33%)
		zf-H2C2_2	550..575	CDD:290200	11/26 (42%)
		C2H2 Zn finger	566..586	CDD:275368	6/19 (32%)
		zf-H2C2_2	578..603	CDD:290200	10/24 (42%)
		C2H2 Zn finger	594..614	CDD:275368	5/19 (26%)
		zf-H2C2_2	606..631	CDD:290200	5/24 (21%)
		ARS2	<620..772	CDD:282772	4/22 (18%)
		C2H2 Zn finger	622..641	CDD:275368	4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000