DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18764 and Zfp369

DIOPT Version :9

Sequence 1:	NP_652712.2	Gene:	CG18764 / 59239	FlyBaseID:	FBgn0042205	Length:	409	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	143	Identity:	58/143 - (40%)
Similarity:	81/143 - (56%)	Gaps:	3/143 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   258 CVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTK 322
            |.|.:||:.|.:...|.:|...|||.:.:.|..|||.|.....:|.|.| ||.||:|::|..|.:
Mouse   701 CQCSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQSSSLTQHLR-IHSGERPFECSECGR 764

  Fly   323 SFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLK 387
            :|.:.:....|.||||.||||.|.||.|.|:.:|...||..||||.|.:.||.|.::|.::::|.
Mouse   765 TFSDRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERPYVCTKCGKAFTQSSNLI 829

  Fly   388 AHLRSKFHTAKAK 400
            .|  .|.|..|.|
Mouse   830 GH--QKTHRKKFK 840

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18764	NP_652712.2	zf-AD	4..75	CDD:214871
		C2H2 Zn finger	260..280	CDD:275368	6/19 (32%)
		zf-H2C2_2	272..297	CDD:290200	10/24 (42%)
		C2H2 Zn finger	288..309	CDD:275368	8/20 (40%)
		C2H2 Zn finger	317..337	CDD:275368	5/19 (26%)
		C2H2 Zn finger	345..365	CDD:275368	8/19 (42%)
		C2H2 Zn finger	373..391	CDD:275368	6/17 (35%)
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	6/19 (32%)
		zf-H2C2_2	715..740	CDD:290200	10/24 (42%)
		COG5048	727..>792	CDD:227381	28/65 (43%)
		C2H2 Zn finger	731..751	CDD:275368	8/20 (40%)
		zf-H2C2_2	743..767	CDD:290200	10/24 (42%)
		zf-C2H2	757..779	CDD:278523	5/21 (24%)
		C2H2 Zn finger	759..779	CDD:275368	5/19 (26%)
		zf-C2H2	785..807	CDD:278523	9/21 (43%)
		C2H2 Zn finger	787..807	CDD:275368	8/19 (42%)
		zf-H2C2_2	799..824	CDD:290200	11/24 (46%)
		C2H2 Zn finger	815..835	CDD:275368	7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000