DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF383

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001332876.1 Gene:ZNF383 / 163087 HGNCID:18609 Length:475 Species:Homo sapiens


Alignment Length:152 Identity:58/152 - (38%)
Similarity:85/152 - (55%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 IIERKRLQR-KRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIH 309
            :|:.:|:.. ::...|:.||:.||..|....|...|||.|.:.|::|||.|.....:..||| ||
Human   269 LIDHQRIHTGEKPYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQR-IH 332

  Fly   310 QGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACT 374
            .|||||:|:.|.|:|.:.:....|:|.||..|||.|..|.|.|..:|..::|:.||.|.:.|.|.
Human   333 TGEKPYECKECGKAFSSGSALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECL 397

  Fly   375 ICKQSFQRNTHLKAHLRSKFHT 396
            .|.::|.:|:.|..|.|  .||
Human   398 ECGKAFTQNSQLFQHQR--IHT 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
ZNF383NP_001332876.1 KRAB 6..66 CDD:214630
zf-C2H2 170..192 CDD:395048
C2H2 Zn finger 172..192 CDD:275368
zf-H2C2_2 187..209 CDD:404364
C2H2 Zn finger 200..220 CDD:275368
zf-H2C2_2 212..237 CDD:404364
C2H2 Zn finger 228..248 CDD:275368
COG5048 <231..475 CDD:227381 58/152 (38%)
C2H2 Zn finger 256..276 CDD:275368 2/6 (33%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
C2H2 Zn finger 312..332 CDD:275368 8/20 (40%)
C2H2 Zn finger 340..360 CDD:275368 6/19 (32%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 396..416 CDD:275368 7/21 (33%)
C2H2 Zn finger 424..444 CDD:275368
C2H2 Zn finger 452..472 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.