DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF550

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001264019.1 Gene:ZNF550 / 162972 HGNCID:28643 Length:422 Species:Homo sapiens


Alignment Length:403 Identity:107/403 - (26%)
Similarity:156/403 - (38%) Gaps:71/403 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LDLNQAILFRERCILTQKQLV---HRRRSPEAKEPAEDVEEM------ASPPDCLND----PFGE 107
            |||.|..|:||..:.|...||   ||...||.....|..:|:      .|...|..|    ...|
Human    29 LDLAQRTLYREVMLETCGLLVSLGHRVPKPELVHLLEHGQELWIVKRGLSHATCAGDRAQVHTRE 93

  Fly   108 VDEY-IVESPEEVLDHDSDAHHDLDEDNYIDSVEDVDALQDM--AEVAEEDSQDVESLISSVQKE 169
            ...| .|.|....|............|:.:....|.:.|.:|  .:|..|.....|:.:..|..|
Human    94 PTTYPPVLSERAFLRGSLTLESSTSSDSRLGRARDEEGLLEMQKGKVTPETDLHKETHLGKVSLE 158

  Fly   170 LESICNDDS-----------------------------NSDNNDYMEPQNGSYFNE---TINEYE 202
            .|.:..||.                             ::..|.|...|.|..||.   .:....
Human   159 GEGLGTDDGLHSRALQEWLSADVLHECDSQQPGKDALIHAGTNPYKCKQCGKGFNRKWYLVRHQR 223

  Fly   203 VSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECV-------- 259
            |.:...   |...:|.|::...::|   ..:.|:........:.:|..:..::|..:        
Human   224 VHTGMK---PYECNACGKAFSQSST---LIRHYLIHTGEKPYKCLECGKAFKRRSYLMQHHPIHT 282

  Fly   260 ------CEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCR 318
                  |.||.:.||.:|.|..|...|||.|.|.|::|.|.| ::....:...|||.|||||||.
Human   283 GEKPYECSQCRKAFTHRSTFIRHNRTHTGEKPFECKECEKAF-SNRAHLIQHYIIHTGEKPYDCM 346

  Fly   319 FCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRN 383
            .|.|:|..|:..:.|:|.||..|||.|..|.|.|..::...:|.:||||...:.|..|.::|:|.
Human   347 ACGKAFRCSSELIQHQRIHTGEKPYECTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRR 411

  Fly   384 THLKAHLRSKFHT 396
            :||..|.|  .||
Human   412 SHLLQHQR--VHT 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 8/18 (44%)
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 11/24 (46%)
C2H2 Zn finger 288..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)
ZNF550NP_001264019.1 KRAB 12..72 CDD:214630 16/42 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..158 8/44 (18%)
COG5048 <200..357 CDD:227381 45/163 (28%)
C2H2 Zn finger 205..225 CDD:275368 4/19 (21%)
C2H2 Zn finger 233..253 CDD:275368 4/22 (18%)
C2H2 Zn finger 261..281 CDD:275368 2/19 (11%)
C2H2 Zn finger 289..309 CDD:275368 8/19 (42%)
C2H2 Zn finger 317..337 CDD:275368 5/20 (25%)
C2H2 Zn finger 345..365 CDD:275368 7/19 (37%)
zf-H2C2_2 357..382 CDD:404364 11/24 (46%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
zf-H2C2_2 385..410 CDD:404364 8/24 (33%)
C2H2 Zn finger 401..421 CDD:275368 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.