DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF641

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_689533.2 Gene:ZNF641 / 121274 HGNCID:31834 Length:438 Species:Homo sapiens


Alignment Length:160 Identity:53/160 - (33%)
Similarity:71/160 - (44%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFC 320
            |...|.|||:||...|:...|...|||.:.::|.:|.|.|...|.:..||: .|..:|...|..|
Human   262 RPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKTFGRRHHLIRHQK-THLHDKTSRCSEC 325

  Fly   321 TKSFHNSNTRLIHERTHTNAKPY---------------------SCHHCDKCFKSASGRK----R 360
            .|:|..::....|:|.|...|..                     .||.|.:|.|| .||:    |
Human   326 GKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTRKRQRAPPVPKCHVCTECGKS-FGRRHHLVR 389

  Fly   361 HELIHTGVRAFACTICKQSFQRNTHLKAHL 390
            |.|.|||.:.|.|..|::||.|..||..||
Human   390 HWLTHTGEKPFQCPRCEKSFGRKHHLDRHL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 8/24 (33%)
C2H2 Zn finger 288..309 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
C2H2 Zn finger 345..365 CDD:275368 11/23 (48%)
C2H2 Zn finger 373..391 CDD:275368 9/18 (50%)
ZNF641NP_689533.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
KRAB 109..170 CDD:214630
KRAB 109..149 CDD:279668
Transactivation 171..265 1/2 (50%)
COG5048 227..>372 CDD:227381 29/110 (26%)
C2H2 Zn finger 266..286 CDD:275368 8/19 (42%)
zf-H2C2_2 278..303 CDD:290200 8/24 (33%)
C2H2 Zn finger 294..314 CDD:275368 7/20 (35%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..367 1/21 (5%)
COG5048 351..>430 CDD:227381 24/70 (34%)
zf-C2H2 372..394 CDD:278523 10/22 (45%)
C2H2 Zn finger 374..394 CDD:275368 9/20 (45%)
zf-H2C2_2 386..411 CDD:290200 11/24 (46%)
C2H2 Zn finger 402..422 CDD:275368 9/18 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..438 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.