DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZNF263

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_005732.2 Gene:ZNF263 / 10127 HGNCID:13056 Length:683 Species:Homo sapiens


Alignment Length:398 Identity:107/398 - (26%)
Similarity:148/398 - (37%) Gaps:122/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RRSPEA-KEPA---------------EDVEEMASP--PDCLNDPFGEVDEYIVESPEEVLDHDSD 125
            :|.|:| ||.|               || :||..|  |:.|.|    |..||   .:|...|...
Human   180 QRDPQAVKERALSAPWLSLFPPEGNMED-KEMTGPQLPESLED----VAMYI---SQEEWGHQDP 236

  Fly   126 AHHDLDEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNNDYMEPQN 190
            :...|..|...:|.|:||:|:     :...||:|...                       ...|.
Human   237 SKRALSRDTVQESYENVDSLE-----SHIPSQEVPGT-----------------------QVGQG 273

  Fly   191 GSYFNETINEYEVSSNPNTPLP-ESK--------SAAGRSTKPATTKPKRKKQYVTWK------- 239
            |..::.::...:...:|..|.| |.|        |....:..|....|.:.:..|.|.       
Human   274 GKLWDPSVQSCKEGLSPRGPAPGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPH 338

  Fly   240 -------------NMTE--------EQIIERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHT-- 281
                         .|.:        .::...|.||.|:..:|..||:.|::.||...|...|.  
Human   339 DRSQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAE 403

  Fly   282 -------------GNKNF-------------ACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFC 320
                         ||..|             .|.:|||.|..:..:|.||| .|.|||||.|..|
Human   404 RLCMGVDCTEIFGGNPRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQR-THTGEKPYQCNIC 467

  Fly   321 TKSFH-NSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNT 384
            .|.|. |||... |:||||..|||.|..|.:.|..:|...||:.||||.|.:.|..|.:||.|::
Human   468 GKCFSCNSNLHR-HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSS 531

  Fly   385 HLKAHLRS 392
            ||..|.|:
Human   532 HLVIHERT 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
zf-H2C2_2 272..297 CDD:290200 11/52 (21%)
C2H2 Zn finger 288..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 9/20 (45%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 8/17 (47%)
ZNF263NP_005732.2 SCAN 38..149 CDD:128708
Dendrin <128..>347 CDD:317849 41/202 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..185 2/4 (50%)
KRAB 218..277 CDD:214630 19/93 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..301 18/98 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..368 3/45 (7%)
C2H2 Zn finger 380..400 CDD:275368 7/19 (37%)
zf-C2H2 380..400 CDD:306579 7/19 (37%)
COG5048 <434..649 CDD:227381 50/108 (46%)
C2H2 Zn finger 436..456 CDD:275368 9/20 (45%)
C2H2 Zn finger 464..484 CDD:275368 9/20 (45%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 9/20 (45%)
C2H2 Zn finger 577..597 CDD:275368
C2H2 Zn finger 605..625 CDD:275368
COG5048 629..>682 CDD:227381
C2H2 Zn finger 633..653 CDD:275368
C2H2 Zn finger 661..681 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.