DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18764 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:159 Identity:59/159 - (37%)
Similarity:87/159 - (54%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 NMTEEQIIERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLH 304
            ::|::.:..|::|..     |..||:.|...|....|...|||.:.:||::|||.|.....:..|
Human   288 DITQQSVDTREKLYE-----CFDCGKAFCQSSKLIRHQRIHTGERPYACKECGKAFSLSSDLVRH 347

  Fly   305 QRIIHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVR 369
            || ||.|||||:|..|.|:|..|:..:.|.|.||..|||.|..|.|.|..:|...:|:.||||.:
Human   348 QR-IHSGEKPYECCECGKAFRGSSELIRHRRIHTGEKPYECGECGKAFSRSSALIQHKKIHTGDK 411

  Fly   370 AFACTICKQSFQRNTHLKAHLRSKFHTAK 398
            ::.|..|.::|.|::.|..|.|  .||.:
Human   412 SYECIACGKAFGRSSILIEHQR--IHTGE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 10/24 (42%)
C2H2 Zn finger 288..309 CDD:275368 8/20 (40%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708
SCAN 44..122 CDD:280241
COG5048 281..>360 CDD:227381 28/77 (36%)
zf-C2H2 301..323 CDD:278523 6/26 (23%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-H2C2_2 316..339 CDD:290200 9/22 (41%)
COG5048 <328..479 CDD:227381 47/114 (41%)
C2H2 Zn finger 331..351 CDD:275368 8/20 (40%)
zf-H2C2_2 343..366 CDD:290200 13/23 (57%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
zf-H2C2_2 371..396 CDD:290200 11/24 (46%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..424 CDD:290200 8/24 (33%)
C2H2 Zn finger 415..435 CDD:275368 7/21 (33%)
zf-H2C2_2 428..452 CDD:290200 5/13 (38%)
C2H2 Zn finger 443..463 CDD:275368
zf-H2C2_2 455..480 CDD:290200
C2H2 Zn finger 471..491 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.