DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13713 and halo

DIOPT Version :10

Sequence 1:NP_652709.1 Gene:CG13713 / 59233 FlyBaseID:FBgn0042199 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001137765.1 Gene:halo / 33334 FlyBaseID:FBgn0001174 Length:109 Species:Drosophila melanogaster


Alignment Length:89 Identity:33/89 - (37%)
Similarity:55/89 - (61%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTVTYHLFLYRVELARRNARQLRLSRTKIEITDELISNTVRNLKTCSLDDLKAVNRELLFKRKLR 73
            |::.|.||.||.||.||:|..:::|..|:.:||.||..|::|::.....::..:|:|:.|||:|.
  Fly    17 PSLHYTLFAYREELRRRDAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRLT 81

  Fly    74 S---NVSKLKKEGMR-QQRQENQD 93
            .   .|.||:|.|:. ..|:.|:|
  Fly    82 KQMRKVRKLEKLGLHIDPRKLNED 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13713NP_652709.1 DUF733 8..92 CDD:428418 31/86 (36%)
haloNP_001137765.1 DUF733 17..100 CDD:428418 30/82 (37%)

Return to query results.
Submit another query.