DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss36

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:113/274 - (41%) Gaps:89/274 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:||........||||||...|.|:||||:.:.:.:::|||||.                    
Mouse    47 RIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFV-------------------- 91

  Fly    91 TDSNGTLV------------------------DVAALIIHEEYA-FDLNINDIAIVRLSTPLEFT 130
              :||||.                        .||.::|.:.|: .:|.. |:|::||::|.:..
Mouse    92 --TNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGA-DLALLRLASPAKLG 153

  Fly   131 SKVQPIPLAKTNPYPRSIAL--------VSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCR- 185
            ..|:|:.|      ||:..|        .:|||   .:.::..| .|..||.:.|.:....:|: 
Mouse   154 PSVRPVCL------PRASHLFAHGTACWATGWG---DVQEAVPLPLPWVLQEVELRLLGEAACQC 209

  Fly   186 LFD------------PSLLCAG--TYGRTACHGDSGGPLVVNKQ----LVGVVSWGRKGC---VS 229
            |:.            |.:||||  ...|..|.||||||||....    |.|:.|:| .||   ..
Mouse   210 LYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFG-FGCGRRNR 273

  Fly   230 SAFFVSVPYFREWI 243
            ...|.:|..:..||
Mouse   274 PGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/272 (27%)
Tryp_SPc 27..243 CDD:238113 73/271 (27%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 75/273 (27%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.