DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and XB5723326

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:256 Identity:67/256 - (26%)
Similarity:108/256 - (42%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQ------YFGDHVCGGSIYSENIIVTAAHCFFD-EEGN------------RLDDQGYQV 84
            ||.||:|      |  .|:|.|:|.:...|:||||||.| :||:            .|.:.|.: 
 Frog    28 PWIVSIQKKVELGY--KHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEIGLR- 89

  Fly    85 RAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSI- 148
                  |.|.|    |..||.|::|......||||:::|...:||:..:|.....|.:...:.: 
 Frog    90 ------TQSRG----VKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLI 144

  Fly   149 -ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-----LFDPSLLCAG--TYGRTACHGD 205
             ..::|||......|..:.:....|...:..|   .|.     :...:.||||  ......|:||
 Frog   145 DCSIAGWGAQGKHLDEPSQFLQEAQVERIDTK---HCNKWYQGILGENHLCAGHRKGPEKTCNGD 206

  Fly   206 SGGPLVVNKQ------LVGVVSWGRKGC---VSSAFFVSVPYFREWILNAI------ASIQ 251
            .|.||:...:      ::|:::|| .||   .|...:..:....:||:..:      |:||
 Frog   207 RGSPLMCRTKKNNVYSVIGILNWG-SGCGQTRSPGVYSPIQSHIKWIVEKVKNEAVKATIQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/240 (26%)
Tryp_SPc 27..243 CDD:238113 62/240 (26%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.